PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.16G029900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 141aa    MW: 15754.2 Da    PI: 7.0867
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.16G029900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.15.4e-4356132278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          Cq+e+C++d+++ak+yhrrhkvCe+h+kap vl++g++qrfCqqCsrfhelsefD++krsCr+rLa+hnerrrk+++
  Manes.16G029900.1.p  56 CQAENCTSDMTNAKQYHRRHKVCEFHAKAPFVLIAGIQQRFCQQCSRFHELSEFDDNKRSCRSRLAGHNERRRKSST 132
                          **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375751.8E-591140IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.105.0E-3450117IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.81253130IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-3954135IPR004333Transcription factor, SBP-box
PfamPF031105.8E-3356129IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MTSSKAEGKR SLKEMEEEED EEDEEDSSGL GFGDDDKKKK GKKGSNGSGS LAAVSCQAEN  60
CTSDMTNAKQ YHRRHKVCEF HAKAPFVLIA GIQQRFCQQC SRFHELSEFD DNKRSCRSRL  120
AGHNERRRKS STDYHGEGSN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3644129184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025578.12e-62Squamosa promoter binding protein-like 3
SwissprotQ387412e-53SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A061GEC82e-62A0A061GEC8_THECC; Squamosa promoter-binding-like protein
STRINGPOPTR_0004s04630.14e-54(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-43squamosa promoter binding protein-like 3